Name :
FKBP1A (Human) Recombinant Protein
Biological Activity :
Human FKBP1A (NP_463460, 1 a.a. – 108 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Protein Accession No. :
NP_463460
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=2280
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Molecular Weight :
14.1
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Conventional Chromatography
Quality Control Testing :
Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer :
In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
Applications :
Functional Study， SDS-PAGE，
Gene Name :
FKBP1A
Gene Alias :
FKBP-12, FKBP1, FKBP12, FKBP12C, PKC12, PKCI2, PPIASE
Gene Description :
FK506 binding protein 1A, 12kDa
Gene Summary :
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq
Other Designations :
FK506-binding protein 1|FK506-binding protein 12|FK506-binding protein 1A (12kD)|FK506-binding protein, T-cell, 12-kD|OTTHUMP00000029978|immunophilin FKBP12|peptidyl-prolyl cis-trans isomerase|protein kinase C inhibitor 2|rotamase
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CNTF web
IL-3 ProteinStorage & Stability
Popular categories:
Tyrosine-protein Kinase Lyn
IGFBP-5