Name :
Btc (Mouse) Recombinant Protein
Biological Activity :
Mouse Btc (Q543J8, 32 a.a. – 111 a.a.) partial recombinant protein expressed in HEK293 cells.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro
Tag :
Protein Accession No. :
Q543J8
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=12223
Amino Acid Sequence :
DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQT PSCICEKGYFGARCERVDLFY
Molecular Weight :
19 ~ 24
Storage and Stability :
Store at 4°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Human
Interspecies Antigen Sequence :
Preparation Method :
_x005f
_x005f
Mammalian cell (HEK 293) expression system_x005f
_x005f
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Applications :
Functional Study， SDS-PAGE，
Gene Name :
Btc
Gene Alias :
–
Gene Description :
betacellulin, epidermal growth factor family member
Gene Summary :
O
Other Designations :
–
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TIM-3 Recombinant Proteins
CD19 Recombinant Proteins
Popular categories:
Ubiquitin-Conjugating Enzyme E2 H
Ubiquitin-Specific Peptidase 32