Name :
CXCL11 (Human) Recombinant Protein
Biological Activity :
Human CXCL11 (O14625, 22 a.a. – 94 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
O14625
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=6373
Amino Acid Sequence :
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Molecular Weight :
8.300000000000001
Storage and Stability :
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from sterile distilled Water up to 0.1 – 1.0 mg/mL
Applications :
Functional Study, SDS-PAGE,
Gene Name :
CXCL11
Gene Alias :
H174, I-TAC, IP-9, IP9, MGC102770, SCYB11, SCYB9B, b-R1
Gene Description :
chemokine (C-X-C motif) ligand 11
Gene Summary :
Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. [provided by RefSeq
Other Designations :
small inducible cytokine B11|small inducible cytokine subfamily B (Cys-X-Cys), member 11|small inducible cytokine subfamily B (Cys-X-Cys), member 9B
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GDNF family medchemexpress
OSM Proteinweb
Popular categories:
Ubiquitin Enzymes
CCR9